Overview

  • Product name

    Recombinant Human CELF-5 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MARLTESEARRQQQQLLQPRPSPVGSSGPEPPGGQPDGMKDLDAIKLFVG QIPRHLDEKDLKPLLEQFGRIYELTVLKDPYTGMHKGCAFLTYCARDSAI KAQTALHEQKTLPGMARPIQVKPADSESRGGRDRKLFVGMLNKQQSEEDV LRLFQPFGVIDECTVLRGPDGSSKGCAFVKFSSHTEAQAAIHALHGSQTM PGASSSLVVKFADTDKERTLRRMQQMVGQLGILTPSLTLPFSPYSAYAQA LMQQQTTVLSTSGSYLSPGVAFSPCHIQQIGAVSLNGLPATPIAPASGLH SPPLLGTTAVPGLVAPITNGFAGVVPFSRWAPCPGNRLCQWPCALPSSEP DCGRDTASCLLRSPAVHSHVPHRGHHAHRAQRPPAAAPPAAAAARRSLET RS
    • Amino acids

      1 to 402
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163737 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as BRUNOL5.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Bruno like 5, RNA binding protein (Drosophila)
    • Bruno like protein 5
    • Bruno-like protein 5
    • BRUNOL 5
    • BRUNOL5
    • CELF 5
    • CELF-5
    • CELF5
    • CELF5_HUMAN
    • CUG BP and ETR 3 like factor 5
    • CUG-BP- and ETR-3-like factor 5
    • CUGBP Elav-like family member 5
    • CUGBP, Elav-like family member 5
    • RNA binding protein BRUNOL5
    • RNA-binding protein BRUNOL-5
    see all
  • Function

    RNA-binding protein implicated in the regulation of pre-mRNA alternative splicing. Mediates exon inclusion and/or exclusion in pre-mRNA that are subject to tissue-specific and developmentally regulated alternative splicing. Specifically activates exon 5 inclusion of cardiac isoforms of TNNT2 during heart remodeling at the juvenile to adult transition. Binds to muscle-specific splicing enhancer (MSE) intronic sites flanking the alternative exon 5 of TNNT2 pre-mRNA.
  • Tissue specificity

    Expressed in brain.
  • Sequence similarities

    Belongs to the CELF/BRUNOL family.
    Contains 3 RRM (RNA recognition motif) domains.
  • Cellular localization

    Nucleus. Cytoplasm.
  • Information by UniProt

Images

  • ab163737 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163737 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163737.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up