Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTAAPGGSAQPAGPGPRLGFSTADSGVGMSGLNPGPAVPMKDHDAIKLFV GQIPRGLDEQDLKPLFEEFGRIYELTVLKDRLTGLHKGCAFLTYCARDSA LKAQSALHEQKTLPGMNRPIQVKPAASEGRGEDRKLFVGMLGKQQGEEDV RRLFQPFGHIEECTVLRSPDGTSKGCAFVKFGSQGEAQAAIRGLHGSRTM AGASSSLVVKLADTDRERALRRMQQMAGHLGAFHPAPLPLGACGAYTTAI LQHQAALLAAAQGPGLGPVAAVAAQMQHVAAFSLVAAPLLPAAAANSPPG SGPGTLPGLPAPIGVNGFGPLTPQTNGQPGSDTLYNNGLSPYPAQSPGVA DPLQQAYAGMHHYAAAYPSAYAPVSTAFPQQPSALPQQQREGPEGCNLFI YHLPQEFGDAELIQTFLPFGAVVSAKVFVDRATNQSKCFGFVSFDNPTSA QTAIQAMNGFQIGMKRLKAQLKRPKDANRPY
    • Amino acids
      1 to 481
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163736 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as BRUNOL6.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 6330569O16Rik
    • bruno like 6, RNA binding protein
    • Bruno like 6, RNA binding protein (Drosophila)
    • Bruno like protein 6
    • Bruno-like protein 6
    • BRUNOL6
    • CELF-6
    • Celf6
    • CELF6_HUMAN
    • CUG-BP- and ETR-3-like factor 6
    • CUGBP and ETR3 like factor 6
    • CUGBP Elav-like family member 6
    • RNA binding protein BRUNOL 6
    • RNA-binding protein BRUNOL-6
    see all
  • Function
    RNA-binding protein implicated in the regulation of pre-mRNA alternative splicing. Mediates exon inclusion and/or exclusion in pre-mRNA that are subject to tissue-specific and developmentally regulated alternative splicing. Specifically activates exon 5 inclusion of TNNT2 in a muscle-specific splicing enhancer (MSE)-dependent manner. Promotes also exon exclusion of INSR pre-mRNA.
  • Tissue specificity
    Expressed mainly in kidney, brain and testis and present in other tissues albeit at lower levels. Also expressed in fetal kidney.
  • Sequence similarities
    Belongs to the CELF/BRUNOL family.
    Contains 3 RRM (RNA recognition motif) domains.
  • Cellular localization
    Nucleus. Cytoplasm.
  • Information by UniProt

Images

  • ab163736 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163736 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163736.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up