Overview

  • Product name
    Recombinant Human CELSR3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      REDGGPGLGVREPIFVGLRGRRQSARNSRGPPEQPNEELGIEHGVQPLGS RERETGQGPGSVLYWRPEVSSCGRTGPLQRGSLSPGALSSGVPGSGNSSP LPSDFLIRHH
    • Amino acids
      71 to 180
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158335 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Anchor protein
    • Cadherin EGF LAG seven-pass G-type receptor 3
    • Cadherin family member 11
    • CDHF11
    • CELR3_HUMAN
    • Celsr3
    • EGF like domain multiple 1
    • EGF-like protein 1
    • EGFL1
    • Epidermal growth factor-like protein 1
    • Flamingo
    • Flamingo homolog 1
    • FMI1
    • hFmi1
    • MEGF2
    • Multiple EGF-like domains protein 2
    • Multiple epidermal growth factor-like domains protein 2
    • RESDA1
    see all
  • Function
    Receptor that may have an important role in cell/cell signaling during nervous system formation.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily.
    Contains 9 cadherin domains.
    Contains 8 EGF-like domains.
    Contains 1 GPS domain.
    Contains 1 laminin EGF-like domain.
    Contains 2 laminin G-like domains.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab158335 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158335 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158335.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up