Description

  • Product name

    Recombinant Human CEND1 protein
  • Purity

    > 85 % SDS-PAGE.
    ab174454 is purified by using conventional chromatography.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMESRGKSASSPKPDTKVPQVTTEAKVP PAADGKAPLTKPSKKEAPAEKQQPPAAPTTAPAKKTSAKADPALLNNHSN LKPAPTVPSSPDATPEPKGPGDGAEEDEAASGGPGGRGPWSCENFNPL
    • Predicted molecular weight

      15 kDa including tags
    • Amino acids

      1 to 125
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Cytoplasmic domain. NCBI Accession No.: NP_057648.

Specifications

Our Abpromise guarantee covers the use of ab174454 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names

    • BM88
    • BM88 antigen
    • Cell cycle exit and neuronal differentiation 1
    • Cell cycle exit and neuronal differentiation protein 1
    • FLJ90066
    • MGC34326
    see all
  • Relevance

    CEND1 is a neuron-specific protein. The similar protein in pig enhances neuroblastoma cell differentiation in vitro and may be involved in neuronal differentiation in vivo. Multiple pseudogenes have been reported for this gene.
  • Cellular localization

    Membrane; Single-pass type IV membrane protein.

Images

  • 15% SDS-PAGE analysis of ab174554 (3 µg)

References

ab174454 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174454.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up