Description

  • Product name

    Recombinant Human CENPC protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAASGLDHLKNGYRRRFCRPSRARDINTEQGQNVLEILQDCFEEKSLAND FSTNSTKSVPNSTRKIKDTCIQSPSKECQKSHPKSVPVSSKKKEASLQFV VEPSEATNRSVQAHEVHQKILATDVSSKNTPDSKKISSRNINDHHSEADE EFYLSVGSPSVLLDAKTSVSQNVIPSSAQKRETYTFENSVNMLPSSTEVS VKTKKRLNFDDKVMLKKIEIDNKVSDEEDKTSEGQERKPSGSSQNRIRDS EYEIQRQAKKSFSTLFLETVKRKSESSPIVRHAATAPPHSCPPDDTKLIE DEFIIDESDQSFASRSWITIPRKAGSLKQRTISPAESTALLQGRKSREKH HNILPKTLANDKHSHKPHPVETSQPSDKTVLDTSYALIGETVNNYRSTKY EMYSKNAEKPSRSKRTIKQKQRRKFMAKPAEEQLDVGQSKDENIHTSHIT QDEFQRNSDRNMEEHEEMGNDCVSKKQMPPVGSKKSSTRKDKEESKKKRF SSESKNKLVPEEVTSTVTKSRRISRRPSDWWVVKSEESCLKC
    • Amino acids

      1 to 542
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152272 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CENP-C
    • CENP-C 1
    • CENPC_HUMAN
    • CENPC1
    • Centromere autoantigen C
    • Centromere autoantigen C1
    • Centromere protein C
    • Centromere protein C 1
    • hcp-4
    • ICEN7
    • Interphase centromere complex protein 7
    • MIF2
    see all
  • Function

    Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be involved in incorporation of newly synthesized CENPA into centromeres. CENPC recruits DNA methylation and DNMT3B to both centromeric and pericentromeric satellite repeats and regulates the histone code in these regions.
  • Sequence similarities

    Belongs to the CENPC family.
  • Domain

    The MIF2 homology domain II targets centromeres and binds the alpha satellite DNA in vivo. The MIF2 homology domain III can induce CENPC dimerization/oligomerization.
  • Cellular localization

    Nucleus. Chromosome > centromere > kinetochore. Localizes exclusively in the kinetochore domain of centromeres.
  • Information by UniProt

Images

  • ab152272 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152272 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152272.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up