Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQT KQQLLEYKSMVDASEEKTPEQIMQEKQIEAKIEDLENEIEEVKVAFEIKK LALDRMRLSTALKKNLEKISRQSSVLMDNMKHLLELNKLIMKSQQESWDL EEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQ NLQMEIKITTVIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM
    • Molecular weight

      53 kDa including tags
    • Amino acids

      1 to 247

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132312 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CENP H
    • CENP-H
    • CENPH
    • CENPH_HUMAN
    • Centromere protein H
    • ICEN35
    • Interphase centromere complex protein 35
    • Kinetochore protein CENP H
    • NNF1
    • NNF1, MIND kinetochore complex component, homolog
    • PMF1
    see all
  • Function

    Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be involved in incorporation of newly synthesized CENPA into centromeres. Required for chromosome congression and efficiently align the chromosomes on a metaphase plate.
  • Sequence similarities

    Belongs to the centromere protein H family.
  • Cellular localization

    Nucleus. Chromosome > centromere > kinetochore. Associates with active centromere-kinetochore complexes throughout the cell cycle. Colocalizes with inner kinetochore plate proteins CENPA and CENPC1 during both interphase and metaphase.
  • Information by UniProt

Images

  • ab132312 on 12.5% SDS-PAGE stained with Coomassie blue.

References

ab132312 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132312.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up