Description

  • Product name

    Recombinant Human Centaurin alpha 1 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAKERRRAVLELLQRPGNARCADCGAPDPDWASYTLGVFICLSCSGIHRN IPQVSKVKSVRLDAWEEAQVEFMASHGNDAARARFESKVPSFYYRPTPSD CQLLREQWIRAKYERQEFIYPEKQEPYSAGYREGFLWKRGRDNGQFLSRK FVLTEREGALKYFNRNDAKEPKAVMKIEHLNATFQPAKIGHPHGLQVTYL KDNSTRNIFIYHEDGKEIVDWFNALRAARFHYLQVAFPGASDADLVPKLS RNYLKEGYMEKTGPKQTEGFRKRWFTMDDRRLMYFKDPLDAFARGEVFIG SKESGYTVLHGFPPSTQGHHWPHGITIVTPDRKFLFACETESDQREWVAA FQKAVDRPMLPQEYAVEAHFKHKP
    • Predicted molecular weight

      70 kDa including tags
    • Amino acids

      1 to 374

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132346 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ArfGAP with dual PH domains 1
    • CENTA 1
    • CENTA1
    • Centaurin alpha
    • GCS1L
    • p42IP4
    • Putative MAPK activating protein PM25
    see all
  • Relevance

    The centaurin alpha 1 protein is a high affinity PtdIns(3,4,5)P3 binding protein enriched in brain. By acting as a GTPase activating protein for ADP ribosylation factor 6 (ARF6), centaurin alpha 1 is able to switch off ARF6 and inhibit its ability to mediate beta 2 adrenoceptor internalization and negatively regulates ARF6 activity by functioning as an in vivo PIP3 dependent ARF6 GAP.
  • Cellular localization

    Cytoplasmic, Nuclear and Plasma membrane

Images

  • 12.5% SDS-PAGE analysis of ab132346 stained with Coomassie Blue.

References

ab132346 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132346.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up