Overview

  • Product name

    Recombinant Human Centaurin alpha 2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGDRERNKKRLLELLRAPDTGNAHCADCGAADPDWASYKLGIFICLNCCG VHRNFPDISRVKSVRLDFWDDSIVEFMIHNGNLRVKAKFEARVPAFYYIP QANDCLVLKEQWIRAKYERREFMADGETISLPGNREGFLWKRGRDNSQFL RRKFVLLAREGLLKYFTKEQGKSPKAVISIKDLNATFQTEKIGHPHGLQI TYRRDGHTRNLFVYHESGKEIVDWFNALRAARLQYLKMAFPELPESELVP FLTRNYLKQGFMEKTGPKKEPFKKRWFALDCHERRLLYYKNPLDAFEQGQ VFLGNKEQGYEAYEDLPKGIRGNRWKAGLTIVTPERRFVLTCPSEKEQQE WLESLRGVLSSPLTPLNRLTASTESGRSSR
    • Molecular weight

      68 kDa including tags
    • Amino acids

      1 to 380

Specifications

Our Abpromise guarantee covers the use of ab132321 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Adap2
    • ADAP2_HUMAN
    • Arf-GAP with dual PH domain-containing protein 2
    • ArfGAP with dual PH domains 2
    • cent b
    • Centa 2
    • CENTA2
    • Centaurin alpha 2
    • Centaurin alpha 2 protein
    • Centaurin beta
    • Centaurin-alpha-2
    • Cnt-a2
    • HSA272195
    see all
  • Function

    GTPase-activating protein for the ADP ribosylation factor family (Potential). Binds phosphatidylinositol 3,4,5-trisphosphate (PtdInsP3) and inositol 1,3,4,5-tetrakisphosphate (InsP4). Possesses a stoichiometry of two binding sites for InsP4 with identical affinity.
  • Tissue specificity

    Highly expressed in placenta, spleen, kidney, skeletal muscle and adrenal gland. Weakly expressed in thyroid, liver, heart, lung, small intestine, peripheral blood leukocytes. Not detected in spinal cord, brain, stomach, trachea, colon, lymph node and bone marrow.
  • Sequence similarities

    Contains 1 Arf-GAP domain.
    Contains 2 PH domains.
  • Cellular localization

    Cytoplasm. Cell membrane. Constitutively associated with the plasma membrane. Excluded from the nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132321 stained with Coomassie Blue.

References

ab132321 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132321.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up