Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VVSTSKSCLLQADSERLLQLWVSAVQSSIASAFSQARLDDSPRGPGQGSG HLAIGSAATLGSGGMARGREPGGVGHVVAQVQSVDGNAQCCDCREPAPEW
    • Amino acids
      331 to 430
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160635 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACAP 1
    • ACAP1
    • ACAP1_HUMAN
    • Arf GAP with coiled coil ANK repeat and PH domains 1
    • Arf GAP with coiled coil, ankyrin repeat, and pleckstrin homology domains 1
    • Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1
    • ArfGAP with coiled-coil, ankyrin repeat and PH domains 1
    • CENT B1
    • Centaurin beta 1
    • Centaurin-beta-1
    • CENTB 1
    • Cnt b1
    • Cnt-b1
    • Cntb1
    • KIAA0050
    see all
  • Function
    GTPase-activating protein (GAP) for ADP ribosylation factor 6 (ARF6) required for clathrin-dependent export of proteins from recycling endosomes to trans-Golgi network and cell surface.
  • Tissue specificity
    Highest level in lung and spleen. Low level in heart, kidney, liver and pancreas.
  • Sequence similarities
    Contains 3 ANK repeats.
    Contains 1 Arf-GAP domain.
    Contains 1 BAR domain.
    Contains 1 PH domain.
  • Domain
    PH domain binds phospholipids including phosphatidic acid, phosphatidylinositol 3-phosphate, phosphatidylinositol 3,5-bisphosphate (PIP2) and phosphatidylinositol 3,4,5-trisphosphate (PIP3). May mediate ACAP1-binding to PIP2 or PIP3 containing membranes.
  • Post-translational
    modifications
    Phosphorylation at Ser-554 by PKB is required for interaction with ITGB1, export of ITGB1 from recycling endosomes to the cell surface and ITGB1-dependent cell migration.
  • Information by UniProt

Images

  • ab160635 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160635 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160635.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up