Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VFQDVAQKVVALRKKQQLAIGPCKSLPNSPSHSAVSAASIPAVHINQATN GGGSAFSDYSSSVPSTPSISQRELRIETIAASSTPTPIRKQSKRRSNI
    • Amino acids
      241 to 338
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165118 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AGAP-3
    • Agap3
    • AGAP3_HUMAN
    • ANK repeat and PH domain-containing protein 3
    • Arf GAP with GTPase, ANK repeat and PH domain containing protein 3
    • Arf-GAP with GTPase
    • ArfGAP with GTPase domain, ankyrin repeat and PH domain
    • ArfGAP with GTPase domain, ankyrin repeat and PH domain 3
    • centaurin gamma 3
    • Centaurin-gamma-3
    • CENTG3
    • Cnt-g3
    • CRAG
    • CRAM-associated GTPase
    • CRMP (collapsin response mediator protein) associated
    • FLJ16146
    • FLJ34452
    • MR1-interacting protein
    • MRIP-1
    • MRIP1
    • OTTHUMP00000213333
    • OTTHUMP00000213334
    • OTTHUMP00000213335
    • OTTHUMP00000213336
    • OTTHUMP00000213337
    see all
  • Function
    GTPase-activating protein for the ADP ribosylation factor family (Potential). GTPase which may be involved in the degradation of expanded polyglutamine proteins through the ubiquitin-proteasome pathway.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the centaurin gamma-like family.
    Contains 3 ANK repeats.
    Contains 1 Arf-GAP domain.
    Contains 1 PH domain.
  • Cellular localization
    Cytoplasm. In cells upon oxidative stress or in brains of Machado-Joseph disease patients, translocates to PML nuclear bodies.
  • Information by UniProt

Images

  • ab165118 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165118 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165118.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up