Description

  • Product name

    Recombinant Human Cer1 protein
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      TRHQDGRQNQSSLSPVLLPRNQRELPTGNHEEAEEKPDLFVAVPHLVGTS PAGEGQRQREKMLSRFGRFWKKPEREMHPSRDSDSEPFPPGTQSLIQPID GMKMEKSPLREEAKKFWHHFMFRKTPASQGVILPIKSHEVHWETCRTVPF SQTITHEGCEKLVVQNNLCFGKCGSVHFPGAAQHSHTSCSHCLPAKFTTM HLPLNCTELSSVIKVVMLVEECQCKVKTEHEDGHILHAGSQDSFIPGVSA VDHHHHHH
    • Predicted molecular weight

      29 kDa including tags
    • Amino acids

      18 to 267
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152052 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    Constituent: 0.12% Acetic acid

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Dissolve the lyophilized protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days. For long term storage aliquot and store at < -20°C.

General Info

  • Alternative names

    • CER 1
    • cer1
    • CER1_HUMAN
    • Cerberus
    • Cerberus 1
    • Cerberus 1 (Xenopus laevis) homolog (cysteine knot superfamily)
    • Cerberus 1 cysteine knot superfamily homolog (Xenopus laevis)
    • Cerberus related 1
    • Cerberus related protein
    • Cerberus-related protein
    • Cerberus1
    • DAN domain family member 4
    • DAND 4
    • DAND4
    • MGC119894
    • MGC119895
    • MGC96951
    see all
  • Function

    Cytokine that may play a role in anterior neural induction and somite formation during embryogenesis in part through a BMP-inhibitory mechanism. Can regulate Nodal signaling during gastrulation as well as the formation and patterning of the primitive streak.
  • Sequence similarities

    Belongs to the DAN family.
    Contains 1 CTCK (C-terminal cystine knot-like) domain.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab152052 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152052.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up