Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPESAWKFLFYLGSWSYSAYLLFGTDYPFFHDPPSVFYDWTPGMAVPRDI AAAYLLQGSFYGHSIYATLYMDTWRKDSVVMLLHHVVTLILIVSSYAFRY HNVGILVLFLHDISDVQLEFTKLNIYFKSRGGSYHRLHALAADLGCLSFG FSWFWFRLYWFPLKVLYATSHCSLRTVPDIPFYFFFNALLLLLTLMNLYW FLYIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAE
    • Amino acids
      1 to 239
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161118 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Ceramide synthase 1
    • CerS1
    • CERS1_HUMAN
    • LAG1
    • LAG1 homolog ceramide synthase 1
    • LAG1 longevity assurance homolog 1
    • LASS 1
    • LASS1
    • Longevity assurance (LAG1 S. cerevisiae) homolog 1
    • Longevity assurance gene 1
    • Longevity assurance gene 1 protein homolog 1
    • MGC90349
    • Protein LAG1
    • Protein UOG 1
    • Protein UOG-1
    • UOG 1 protein
    • UOG1
    • Upstream of GDF1
    see all
  • Function
    May be either a bona fide (dihydro)ceramide synthase or a modulator of its activity. When overexpressed in cells is involved in the production of sphingolipids containing mainly one fatty acid donor (N-linked stearoyl- (C18) ceramide) in a fumonisin B1-independent manner.
  • Sequence similarities
    Contains 1 TLC (TRAM/LAG1/CLN8) domain.
  • Cellular localization
    Endoplasmic reticulum membrane and Endoplasmic reticulum membrane. Golgi apparatus membrane. Isoform 1 may recycle from the Golgi to the endoplasmic reticulum.
  • Information by UniProt

Images

  • ab161118 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161118 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161118.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up