Overview

  • Product name

    Recombinant Human Ceramide synthase 1/LAG1 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      YIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF
    • Amino acids

      301 to 350
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161119 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as Ceramide synthase 1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Ceramide synthase 1
    • CerS1
    • CERS1_HUMAN
    • LAG1
    • LAG1 homolog ceramide synthase 1
    • LAG1 longevity assurance homolog 1
    • LASS 1
    • LASS1
    • Longevity assurance (LAG1 S. cerevisiae) homolog 1
    • Longevity assurance gene 1
    • Longevity assurance gene 1 protein homolog 1
    • MGC90349
    • Protein LAG1
    • Protein UOG 1
    • Protein UOG-1
    • UOG 1 protein
    • UOG1
    • Upstream of GDF1
    see all
  • Function

    May be either a bona fide (dihydro)ceramide synthase or a modulator of its activity. When overexpressed in cells is involved in the production of sphingolipids containing mainly one fatty acid donor (N-linked stearoyl- (C18) ceramide) in a fumonisin B1-independent manner.
  • Sequence similarities

    Contains 1 TLC (TRAM/LAG1/CLN8) domain.
  • Cellular localization

    Endoplasmic reticulum membrane and Endoplasmic reticulum membrane. Golgi apparatus membrane. Isoform 1 may recycle from the Golgi to the endoplasmic reticulum.
  • Information by UniProt

Images

  • ab161119 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161119 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161119.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up