Recombinant Human Ceramide synthase 2 protein (ab162288)

Overview

  • Product name
    Recombinant Human Ceramide synthase 2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLQTLYDYFWWERLWLPVNLTWADLEDRDGRVYAKASDLYITLPLALLFL IVRYFFELYVATPLAALLNIKEKTRLRAPPNATLEHFYLTSGKQPKQVEV ELLSRQSGLSGRQVERWFRRRRNQDRPSLLKKFREASWRFTFYLIAFIAG MAVIVDKPWFYDMKKVWEGYPIQSTIPSQYWYYMIELSFYWSLLFSIASD VKRKDFKEQIIHHVATIILISFSWFANYIRAGTLIMALHDSSDYLLESAK MFNYAGWKNTCNNIFIVFAIVFIITRLVILPFWILHCTLVYPLELYPAFF GYYFFNSMMGVLQLLHIFWAYLILRMAHKFITGKLVEDERSDREETESSE GEEAAAGGGAKSRPLANGHPILNNNHRKND
    • Amino acids
      1 to 380
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162288 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Ceramide synthase 2
    • CerS 2
    • CerS2
    • CERS2_HUMAN
    • FLJ10243
    • L3
    • LAG1 homolog ceramide synthase 2
    • LAG1 longevity assurance 2
    • LAG1 longevity assurance homolog 2
    • LASS 2
    • Longevity assurance (LAG1 S. cerevisiae) homolog 2
    • MGC987
    • SP 260
    • SP260
    • TMSG 1
    • TMSG1
    • Tumor metastasis suppressor
    • Tumor metastasis suppressor gene 1 protein
    • Tumor metastasis-suppressor gene 1 protein
    see all
  • Function
    Suppresses the growth of cancer cells. May be involved in sphingolipid synthesis.
  • Tissue specificity
    Expressed in kidney, liver, brain, heart, placenta and lung.
  • Sequence similarities
    Contains 1 homeobox DNA-binding domain.
    Contains 1 TLC (TRAM/LAG1/CLN8) domain.
  • Cellular localization
    Nucleus membrane. Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab162288 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162288 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162288.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up