Overview

  • Product name

    Recombinant Human CES2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MTAQSRSPTTPTFPGPSQRTPLTPCPVQTPRLGKALIHCWTDPGQPLGEQ QRVRRQRTETSEPTMRLHRLRARLSAVACGLLLLLVRGQGQDSASPIRTT HTGQVLGSLVHVKGANAGVQTFLGIPFAKPPLGPLRFAPPEPPESWSGVR DGTTHPAMCLQDLTAVESEFLSQFNMTFPSDSMSEDCLYLSIYTPAHSHE GSNLPVMVWIHGGALVFGMASLYDGSMLAALENVVVVIIQYRLGVLGFFS TGDKHATGNWGYLDQVAALRWVQQNIAHFGGNPDRVTIFGESAGGTSVSS LVVSPISQGLFHGAIMESGVALLPGLIASSADVISTVVANLSACDQVDSE ALVGCLRGKSKEEILAINKPFKMIPGVVDGVFLPRHPQELLASADFQPVP SIVGVNNNEFGWLIPKVMRIYDTQKEMDREASQAALQKMLTLLMLPPTFG DLLREEYIGDNGDPQTLQAQFQEMMADSMFVIPALQVAHFQCSRAPVYFY EFQHQPSWLKNIRPPHMKADHGDELPFVFRSFFGGNYIKFTEEEEQLSRK MMKYWANFARNGNPNGEGLPHWPLFDQEEQYLQLNLQPAVGRALKAHRLQ FWKKALPQKIQELEEPEERHTEL
    • Molecular weight

      95 kDa including tags
    • Amino acids

      1 to 623

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132595 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Carboxylesterase 2
    • Carboxylesterase 2 (intestine, liver)
    • CE-2
    • CES2
    • CES2A1
    • Cocaine esterase
    • EC 3.1.1.1
    • EST2_HUMAN
    • hCE-2
    • ICE
    • Iintestinal carboxylesterase liver carboxylesterase 2
    • Intestinal carboxylesterase; liver carboxylesterase-2
    • Methylumbelliferyl acetate deacetylase 2
    • PCE 2
    • PCE-2
    see all
  • Function

    Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Shows high catalytic efficiency for hydrolysis of cocaine, 4-methyumbelliferyl acetate, heroin and 6-monoacetylmorphine.
  • Tissue specificity

    Preferentially expressed in intestine with moderate expression in liver. Within the intestine, highest expression is found in small intestine with lower expression in colon and rectum.
  • Sequence similarities

    Belongs to the type-B carboxylesterase/lipase family.
  • Post-translational
    modifications

    Glycosylated.
  • Cellular localization

    Endoplasmic reticulum lumen.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132595 stained with Coomassie Blue.

References

ab132595 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132595.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up