Description

  • Product name

    Recombinant Human CFHR5 protein
  • Purity

    > 95 % SDS-PAGE.
    Determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EGTLCDFPKIHHGFLYDEEDYNPFSQVPTGEVFYYSCEYNFVSPSKSFWT RITCTEEGWSPTPKCLRMCSFPFVKNGHSESSGLIHLEGDTVQIICNTGY SLQNNEKNISCVERGWSTPPICSFTKGECHVPILEANVDAQPKKESYKVG DVLKFSCRKNLIRVGSDSVQCYQFGWSPNFPTCKGQVRSCGPPPQLSNGE VKEIRKEEYGHNEVVEYDCNPNFIINGPKKIQCVDGEWTTLPTCVEQVKT CGYIPELEYGYVQPSVPPYQHGVSVEVNCRNEYAMIGNNMITCINGIWTE LPMCVATHQLKRCKIAGVNIKTLLKLSGKEFNHNSRIRYRCSDIFRYRHS VCINGKWNPEVDCTEKREQFCPPPPQIPNAQNMTTTVNYQDGEKVAVLCK ENYLLPEAKEIVCKDGRWQSLPRCVESTAYCGPPPSINNGDTTSFPLSVY PPGSTVTYRCQSFYKLQGSVTVTCRNKQWSEPPRCLDPCVVSEENMNKNN IQLKWRNDGKLYAKTGDAVEFQCKFPHKAMISSPPFRAICQEGKFEYPIC EVDHHHHHH
    • Predicted molecular weight

      64 kDa including tags
    • Amino acids

      19 to 569
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein from aa 19 to 569. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab192294 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Additional notes

    Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
    Aliquots of reconstituted samples are stable at < -20°C for 3 months.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 99% Phosphate Buffer, 0.87% Sodium chloride

    Lyophilized from a 0.2 µM filtered solution

General Info

  • Alternative names

    • CFHL5
    • CFHR5
    • CFHR5D
    • Complement factor H-related 5
    • Complement factor H-related protein 5
    • factor H-related gene 5
    • factor H-related protein 5
    • FHR-5
    • FHR5
    • FHR5_HUMAN
    • FLJ10549
    • MGC133240
    • OTTHUMP00000034672
    see all
  • Function

    Involved in complement regulation.
  • Tissue specificity

    Expressed by the liver and secreted in plasma.
  • Involvement in disease

    Note=Defects in CFHR5 have been found in patients with atypical hemolytic uremic syndrome and may contribute to the disease. Atypical hemolytic uremic syndrome is a complex genetic disease characterized by microangiopathic hemolytic anemia, thrombocytopenia, renal failure and absence of episodes of enterocolitis and diarrhea. In contrast to typical hemolytic uremic syndrome, atypical forms have a poorer prognosis, with higher death rates and frequent progression to end-stage renal disease. Susceptibility to the development of atypical hemolytic uremic syndrome can be conferred by mutations in various components of or regulatory factors in the complement cascade system. Other genes may play a role in modifying the phenotype.
  • Sequence similarities

    Contains 9 Sushi (CCP/SCR) domains.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab192294 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192294.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up