Recombinant Human cGKII protein (Tagged) (ab159214)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGNGSVKPKHSKHPDGHSGNLTTDALRNKVTELERELRRKDAEIQEREYH LKELREQLSKQTVAIAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDK VPLEVHRKTSGLVSLHSRRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVR KDSSEKKLITDALNKNQFLKRLDPQQIKDMVECMYGRNYQQGSYIIKQGE PGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAIT NVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIID CLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQ KGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKY LEGYVANLNRDDEKRHAKRSMSNWKLSKALSLEMIQLKEKVARFSSSSPF QNLEIIATLGVGGFGRVELVKVKNENVAFAMKCIRKKHIVDTKQQEHVYS EKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDE PTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKK IGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPF SGVDQMMTYNLILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKN GINDIKKHRWLNGFNWEGLKARSLPSPLQRELKGPIDHSYFDKYPPEKGM PPDELSGWDKDF
    • Amino acids
      1 to 762
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159214 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Protein previously known as CGK2.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CGK 2
    • cGK2
    • cGKII
    • cGMP dependent protein kinase 2
    • cGMP-dependent protein kinase 2
    • cGMP-dependent protein kinase II
    • KGP2_HUMAN
    • PRKG 2
    • PRKG2
    • PRKGR2
    • Protein kinase, cGMP dependent, type II
    • Type II cGMP dependent protein kinase
    see all
  • Tissue specificity
    Highly concentrated in brain, lung and intestinal mucosa.
  • Sequence similarities
    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. cGMP subfamily.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 2 cyclic nucleotide-binding domains.
    Contains 1 protein kinase domain.
  • Information by UniProt

Images

  • ab159214 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159214 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159214.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up