Description

  • Product name

    Recombinant Human CGT protein
    See all CGT proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      FESHMYIFKTLASALHERGHHTVFLLSEGRDIAPSNHYSLQRYPGIFNST TSDAFLQSKMRNIFSGRLTAIELFDILDHYTKNCDLMVGNHALIQGLKKE KFDLLLVDPN
    • Predicted molecular weight

      38 kDa including tags
    • Amino acids

      31 to 140

Specifications

Our Abpromise guarantee covers the use of ab152787 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

     This product was previously labelled as UGT8

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 2 hydroxyacylsphingosine 1 beta galactosyltransferase
    • 2-hydroxyacylsphingosine 1-beta-galactosyltransferase
    • Ceramide UDP galactosyltransferase
    • Ceramide UDP-galactosyltransferase
    • Cerebroside synthase
    • CGT
    • CGT_HUMAN
    • mCerGT
    • UDP galactose ceramide galactosyltransferase
    • UDP galactose ceramide galactosyltransferase 8
    • UDP glycosyltransferase 8
    • UDP-galactose-ceramide galactosyltransferase
    • UGT4
    • Ugt8
    • Uridine diphosphate glycosyltransferase 8
    see all
  • Function

    Catalyzes the transfer of galactose to ceramide, a key enzymatic step in the biosynthesis of galactocerebrosides, which are abundant sphingolipids of the myelin membrane of the central nervous system and peripheral nervous system.
  • Pathway

    Sphingolipid metabolism; galactosylceramide biosynthesis.
  • Sequence similarities

    Belongs to the UDP-glycosyltransferase family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab152787 stained with Coomassie Blue.

References

ab152787 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152787.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up