Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGGTTSTRRVTFEADENENITVVKGIRLSENVIDRMKESSPSGSKSQRYS GAYGASVSDEELKRRVAEELALEQAKKESEDQKRLKQAKELDRERAAANE QLTRAILRERICSEEERAKAKHLARQLEEKDRVLKKQDAFYKEQLARLEE RSSEFYRVTTEQYQKAAEEVEAKFKRYESHPVCADLQAKILQCYRENTHQ TLKCSALATQYMHCVNHAKQSMLEKGG
    • Amino acids
      1 to 227
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162897 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CHCH3_HUMAN
    • CHCHD 3
    • Chchd3
    • Coiled coil helix coiled coil helix domain containing 3
    • Coiled coil helix coiled coil helix domain containing protein 3 mitochondrial
    • Coiled-coil-helix-coiled-coil-helix domain-containing protein 3
    • FLJ20420
    • MINOS3
    • mitochondrial
    • Mitochondrial inner membrane organizing system 3
    • PPP1R22
    • Protein phosphatase 1 regulatory subunit 22
    see all
  • Function
    Required for maintenance of mitochondrial crista integrity and mitochondrial function. May act as a scaffolding protein that stabilizes protein complexes involved in crista architecture and protein import. Has also been shown to function as a transcription factor which binds to the BAG1 promoter and represses BAG1 transcription.
  • Tissue specificity
    Detected at low levels in brain, placenta, lung, liver, kidney and pancreas with increased levels in heart and skeletal muscle. Higher expression in primary lung cancers than in normal lung tissue.
  • Sequence similarities
    Contains 1 CHCH domain.
  • Cellular localization
    Mitochondrion inner membrane. Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab162897 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162897 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Question
Answer

The protein is tagged with GST at N-terminus.

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up