Description

  • Product name

    Recombinant Human CHD2 protein
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSSETIEKVLDSRLGKKGATG ASTTVYAIEANGDPSGDFDTEKDEGEIQYLIKWKGWSYIHSTWESEESLQ QQKVKGLKKLENFKKKEDEIKQWLGKVSPEDVEYFNCQQELASELNKQYQ IVERVIAVKTSKSTLGQTDFPAHSRKPAPSNEPEYLCKWMGLPYSECSWE DEALIGKKFQNCIDSFHSRNNSKTIPTR
    • Predicted molecular weight

      49 kDa including tags
    • Amino acids

      260 to 456
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab198642 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.017% Potassium chloride, 20% Glycerol

General Info

  • Alternative names

    • 2810013C04Rik
    • 2810040A01Rik
    • 5630401D06Rik
    • AI851092
    • ATP dependent helicase CHD2
    • ATP-dependent helicase CHD2
    • BC029703
    • CHD 2
    • CHD-2
    • CHD2
    • CHD2_HUMAN
    • chromodomain helicase dna binding protein
    • Chromodomain-helicase-DNA-binding protein 2
    • DKFZp547I1315
    • DKFZp686E01200
    • DKFZP781D1727
    • EC 3.6.1.-
    • EEOC
    • FLJ38614
    see all
  • Function

    Sequence-selective DNA-binding protein.
  • Sequence similarities

    Belongs to the SNF2/RAD54 helicase family.
    Contains 2 chromo domains.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE with Coomassie staining.

    Lane 1: 2 µg ab198642
    Lane 2: Protein marker

References

ab198642 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198642.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up