Overview

  • Product name

    Recombinant Human CHD8 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      EGLKLTFQKHKLMANGVMGDGHPLFHKKKGNRKKLVELEVECMEEPNHLD VDLETRIPVINKVDGTLLVGEDAPRRAELEMWLQGHPEFAVDPRFLAYM
    • Amino acids

      1980 to 2078
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153461 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ATP dependent helicase CHD8
    • ATP-dependent helicase CHD8
    • Axis duplication inhibitor
    • Beta catenin binding protein like
    • CHD 8
    • CHD-8
    • chd8
    • CHD8_HUMAN
    • Chromodomain helicase DNA binding protein 8
    • Chromodomain-helicase-DNA-binding protein 8
    • DKFZp686N17164
    • Duplin
    • Helicase with SNF2 domain 1
    • HELSNF1
    • KIAA1564
    see all
  • Function

    DNA helicase that acts as a chromatin remodeling factor and regulates transcription. Acts as a transcription repressor by remodeling chromatin structure and recruiting histone H1 to target genes. Suppresses p53/TP53-mediated apoptosis by recruiting histone H1 and preventing p53/TP53 transactivation activity. Acts as a negative regulator of Wnt signaling pathway by regulating beta-catenin (CTNNB1) activity. Negatively regulates CTNNB1-targeted gene expression by being recruited specifically to the promoter regions of several CTNNB1 responsive genes. Involved in both enhancer blocking and epigenetic remodeling at chromatin boundary via its interaction with CTCF. Acts as a suppressor of STAT3 activity by suppressing the LIF-induced STAT3 transcriptional activity. Also acts as a transcription activator via its interaction with ZNF143 by participating to efficient U6 RNA polymerase III transcription.
  • Sequence similarities

    Belongs to the SNF2/RAD54 helicase family. CHD8 subfamily.
    Contains 2 chromo domains.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Post-translational
    modifications

    Sumoylated.
  • Cellular localization

    Nucleus. Localizes to the promoter regions of several CTNNB1-responsive genes. Also present at known CTCF target sites.
  • Information by UniProt

Images

  • ab153461 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153461 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153461.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up