Recombinant Human Chemokine Receptor D6 protein (ab158147)

Overview

  • Product name
    Recombinant Human Chemokine Receptor D6 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAATASPQPLATEDADSENSSFYYYDYLDEVAFMLCRKDAVVSFGKVFLP VFYSLIFVLGLSGNLLLLMVLLRYVPRRRMVEIYLLNLAISNLLFLVTLP FWGISVAWHWVFGSFLCKMVSTLYTINFYSGIFFISCMSLDKYLEIVHAQ PYHRLRTRAKSLLLATIVWAVSLAVSIPDMVFVQTHENPKGVWNCHADFG GHGTIWKLFLRFQQNLLGFLLPLLAMIFFYSRIGCVLVRLRPAGQGRALK IAAALVVAFFVLWFPYNLTLFLHTLLDLQVFGNCEVSQHLDYALQVTESI AFLHCCFSPILYAFSSHRFRQYLKAFLAAVLGWHLAPGTAQASLSSCSES SILTAQEEMTGMNDLGERQSENYPNKEDVGNKSA
    • Amino acids
      1 to 384
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158147 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C C chemokine receptor D6
    • C-C chemokine receptor D6
    • CC chemokine binding receptor JAB61
    • CC chemokine receptor D6
    • CCBP 2
    • CCBP2
    • CCBP2_HUMAN
    • CCR 10
    • CCR 9
    • CCR10
    • CCR9
    • Chemokine (C C motif) receptor 9
    • Chemokine (C C) receptor 9
    • Chemokine binding protein 2
    • Chemokine binding protein D6
    • Chemokine C C motif receptor 9
    • Chemokine C C receptor 9
    • Chemokine CC motif receptor 9
    • Chemokine CC receptor 9
    • Chemokine receptor 9
    • Chemokine receptor CCR 10
    • Chemokine receptor CCR 9
    • Chemokine receptor CCR-10
    • Chemokine receptor CCR-9
    • Chemokine receptor CCR10
    • Chemokine receptor CCR9
    • Chemokine receptor D6
    • Chemokine-binding protein 2
    • Chemokine-binding protein D6
    • CMKBR 9
    • CMKBR9
    • D6
    • hD6
    • MGC126678
    • MGC138250
    see all
  • Function
    Receptor for C-C type chemokines including SCYA2/MCP-1, SCY3/MIP-1-alpha, SCYA5/RANTES and SCYA7/MCP-3.
  • Tissue specificity
    Expressed primarily in placenta and fetal liver, and found at very low levels in the lung and lymph node. Found in endothelial cells lining afferent lymphatics in dermis and lymph nodes. Also found in lymph nodes subcapsular and medullary sinuses, tonsillar lymphatic sinuses and lymphatics in mucosa and submucosa of small and large intestine and appendix. Also found in some malignant vascular tumors.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab158147 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158147 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158147.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up