Recombinant Human CHIC2 protein (ab161991)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINR VNSCLKKNLPVNVR
    • Amino acids
      21 to 84
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161991 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BrX-like translocated in leukemia
    • BTL
    • Chic2
    • CHIC2_HUMAN
    • Cystein-rich hydrophobic domain 2
    • Cysteine-rich hydrophobic domain 2 protein
    • MGC21173
    see all
  • Involvement in disease
    Note=A chromosomal aberration involving CHIC2 is found in a form of acute myeloid leukemia (AML). Translocation t(4;12)(q12;p13) with ETV6.
  • Sequence similarities
    Belongs to the CHIC family.
  • Post-translational
    modifications
    Palmitoylation in the CHIC motif is required for membrane association.
  • Cellular localization
    Cell membrane. Cytoplasmic vesicle. Also present at a Golgi-like vesicular compartment and at scattered vesicles.
  • Information by UniProt

Images

  • ab161991 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161991 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161991.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up