Description

  • Product name

    Recombinant Human CHIT1 protein
    See all CHIT1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEW NDETLYQEFNGLKKMNPKLKTLLAIGGWNFSTQKFTDMVATANNRQTFVN SAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQ TSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKV TGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSF TLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQK VPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCN QGRYPLIQTLRQELSLPYLPSGTPELEVPKPGQPSEPEHGPSPGQDTFCQ GKADGLYPNPRERSSFYSCAGGRLFQQSCPTGLVFSNSCKCCTWN
    • Predicted molecular weight

      51 kDa including tags
    • Amino acids

      22 to 466
    • Tags

      His tag C-Terminus
    • Additional sequence information

      AAI03696.

Specifications

Our Abpromise guarantee covers the use of ab205999 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris, 0.87% Sodium chloride, 5% Trehalose

    Lyophilised from a 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CHI3
    • CHIT
    • CHIT1
    • CHIT1_HUMAN
    • CHITD
    • Chitinase 1
    • Chitinase 1 (chitotriosidase)
    • Chitinase-1
    • Chitotriosidase
    • Chitotriosidase-1
    • EC 3.2.1.14
    • FLJ00314
    • MGC125322
    • Plasma methylumbelliferyl tetra N acetylchitotetraoside hydrolase
    see all
  • Function

    Degrades chitin, chitotriose and chitobiose. May participate in the defense against nematodes and other pathogens. Isoform 3 has no enzymatic activity.
  • Tissue specificity

    Detected in spleen. Secreted by cultured macrophages.
  • Sequence similarities

    Belongs to the glycosyl hydrolase 18 family. Chitinase class II subfamily.
    Contains 1 chitin-binding type-2 domain.
  • Cellular localization

    Secreted. Lysosome. A small proportion is lysosomal.
  • Information by UniProt

Images

  • SDS-PAGE analysis of DTT-reduced ab205999 stained overnight with Coomassie Blue.

    DTT-reduced protein migrates as 52 kDa in SDS-PAGE due to glycosylation.

References

ab205999 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab205999.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up