Overview

  • Product name

    Recombinant Human CHN 1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MALTLFDTDEYRPPVWKSYLYQLQQEAPHPRRITCTCEVENRPKYYGREF HGMISREAADQLLIVAEGSYLIRESQRQPGTYTLALRFGSQTRNFRLYYD GKHFVGEKRFESIHDLVTDGLITLYIETKAAEYIAKMTINPIYEHVGYTT LNREPAYKKHMPVLKETHDERDSTGQDGVSEKRLTSLVRRATLKENEQIP KYEKIHNFKVHTFRGPHWCEYCANFMWGLIAQGVKCADCGLNVHKQCSKM VPNDCKPDLKHVKKVYSCDLTTLVKAHTTKRPMVVDMCIREIESRGLNSE GLYRVSGFSDLIEDVKMAFDRDGEKADISVNMYEDINIITGALKLYFRDL PIPLITYDAYPKFIESAKIMDPDEQLETLHEALKLLPPAHCETLRYLMAH LKRVTLHEKENLMNAENLGIVFGPTLMRSPELDAMAALNDIRYQRLVVEL LIKNEDILF
    • Amino acids

      1 to 459
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158112 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • A-chimaerin
    • Alpha-chimerin
    • ARHGAP2
    • CHIN_HUMAN
    • CHN
    • Chn1
    • N chimaerin
    • N chimerin
    • N-chimaerin
    • N-chimerin
    • NC
    • Rho GTPase-activating protein 2
    • RHOGAP2
    see all
  • Function

    GTPase-activating protein for p21-rac and a phorbol ester receptor. May play an important role in neuronal signal-transduction mechanisms.
  • Tissue specificity

    In neurons in brain regions that are involved in learning and memory processes.
  • Involvement in disease

    Defects in CHN1 are the cause of Duane retraction syndrome type 2 (DURS2) [MIM:604356]. Duane retraction syndrome is a congenital eye movement disorder characterized by a failure of cranial nerve VI (the abducens nerve) to develop normally, resulting in restriction or absence of abduction, adduction, or both, and narrowing of the palpebral fissure and retraction of the globe on attempted adduction. Undiagnosed in children, it can lead to amblyopia, a permanent uncorrectable loss of vision.
  • Sequence similarities

    Contains 1 phorbol-ester/DAG-type zinc finger.
    Contains 1 Rho-GAP domain.
    Contains 1 SH2 domain.
  • Developmental stage

    Increases in amount during brain development coincident with synaptogenesis.
  • Information by UniProt

Images

  • ab158112 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158112 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158112.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up