Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QTRNFRLYYDGKHFVGEKRFESIHDLVTDGLITLYIETKAAEYIAKMTIN PIYEHVGYTTLNREPAYKKHMPVLKETHDERDSTGQDGVSEKRLTSLVRR ATLKENEQIP
    • Amino acids
      91 to 200
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158113 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A-chimaerin
    • Alpha-chimerin
    • ARHGAP2
    • CHIN_HUMAN
    • CHN
    • Chn1
    • N chimaerin
    • N chimerin
    • N-chimaerin
    • N-chimerin
    • NC
    • Rho GTPase-activating protein 2
    • RHOGAP2
    see all
  • Function
    GTPase-activating protein for p21-rac and a phorbol ester receptor. May play an important role in neuronal signal-transduction mechanisms.
  • Tissue specificity
    In neurons in brain regions that are involved in learning and memory processes.
  • Involvement in disease
    Defects in CHN1 are the cause of Duane retraction syndrome type 2 (DURS2) [MIM:604356]. Duane retraction syndrome is a congenital eye movement disorder characterized by a failure of cranial nerve VI (the abducens nerve) to develop normally, resulting in restriction or absence of abduction, adduction, or both, and narrowing of the palpebral fissure and retraction of the globe on attempted adduction. Undiagnosed in children, it can lead to amblyopia, a permanent uncorrectable loss of vision.
  • Sequence similarities
    Contains 1 phorbol-ester/DAG-type zinc finger.
    Contains 1 Rho-GAP domain.
    Contains 1 SH2 domain.
  • Developmental stage
    Increases in amount during brain development coincident with synaptogenesis.
  • Information by UniProt

Images

  • ab158113 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158113 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158113.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up