Overview

  • Product name
    Recombinant Human CHORDC1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MALLCYNRGCGQRFDPETNSDDACTYHPGVPVFHDALKGWSCCKRRTTDF SDFLSIVGCTKGRHNSEKPPEPVKPEVKTTEKKELCELKPKFQEHIIQAP KPVEAIKRPSPDEPMTNLELKISASLKQALDKLKLSSGNEENKKEEDNDE IKIGTSCKNGGCSKTYQGLESLEEVCVYHSGVPIFHEGMKYWSCCRRKTS DFNTFLAQEGCTKGKHMWTKKDAGKKVVPCRHDWHQTGGEVTISVYAKNS LPELSRVEANSTLLNVHIVFEGEKEFDQNVKLWGVIDVKRSYVTMTATKI EITMRKAEPMQWASLELPAAKKQEKQKDATTD
    • Amino acids
      1 to 332
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162046 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CHORD containing protein 1
    • Chord domain containing protein 1
    • CHORD domain-containing protein 1
    • CHORD-containing protein 1
    • CHORDC1
    • CHP-1
    • CHP1
    • CHRD1_HUMAN
    • Cysteine and histidine rich domain (CHORD) containing 1
    • Cysteine and histidine rich domain (CHORD) containing, zinc binding protein 1
    • Cysteine and histidine rich domain containing 1
    • Cysteine and histidine rich domain containing zinc binding protein 1
    • Cysteine and histidine-rich domain-containing protein 1
    • FLJ37289
    • Protein morgana
    see all
  • Function
    Regulates centrosome duplication, probably by inhibiting the kinase activity of ROCK2. Proposed to act as co-chaperone for HSP90. May play a role in the regulation of NOD1 via a HSP90 chaperone complex. In vitro, has intrinsic chaperone activity. This function may be achieved by inhibiting association of ROCK2 with NPM1. Involved in stress response. Prevents tumorigenesis.
  • Tissue specificity
    Underexpressed in many breast and lung cancers.
  • Sequence similarities
    Contains 2 CHORD domains.
    Contains 1 CS domain.
  • Information by UniProt

Images

  • ab162046 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162046 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162046.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up