Overview

  • Product name

    Recombinant Human CHRDL1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MGGMKYIFSLLFFLLLEGGKTEQVKHSETYCMFQDKKYRVGERWHPYLEP YGLVYCVNCICSENGNVLCSRVRCPNVHCLSPVHIPHLCCPRCPDSLPPV NNKVTSKSCEYNGTTYQHGELFVAEGLFQNRQPNQCTQCSCSEGNVYCGL KTCPKLTCAFPVSVPDSCCRVCRGDGELSWEHSDGDIFRQPANREARHSY HRSHYDPPPSRQAGGLSRFPGARSHRGALMDSQQASGTIVQIVINNKHKH GQVCVSNGKTYSHGESWHPNLRAFGIVECVLCTCNVTKQECKKIHCPNRY PCKYPQKIDGKCCKVCPGKKAKELPGQSFDNKGYFCGEETMPVYESVFME DGETTRKIALETERPPQVEVHVWTIRKGILQHFHIEKISKRMFEELPHFK LVTRTTLSQWKIFTEGEAQISQMCSSRVCRTELEDLVKVLYLERSEKGHC
    • Amino acids

      1 to 450
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164881 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CHL
    • chordin like 1
    • Chordin-like protein 1
    • CHRDL1
    • CRDL1_HUMAN
    • dA141H5.1
    • neuralin 1
    • Neuralin-1
    • Neurogenesin-1
    • NRLN1
    • Ventroptin
    • VOPT
    see all
  • Function

    Antagonizes the function of BMP4 by binding to it and preventing its interaction with receptors. Alters the fate commitment of neural stem cells from gliogenesis to neurogenesis. Contributes to neuronal differentiation of neural stem cells in the brain by preventing the adoption of a glial fate. May play a crucial role in dorsoventral axis formation. May play a role in embyonic bone formation (By similarity). May also play an important role in regulating retinal angiogenesis trough modulation of BMP4 actions in endothelial cells.
  • Tissue specificity

    Expressed in retinal pericytes.
  • Sequence similarities

    Contains 3 VWFC domains.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • ab164881 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164881 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164881.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up