Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPVYESVFMEDGETTRKIALETERPPQVEVHVWTIRKGILQHFHIEKISK RMFEELPHFKLVTRTTLSQWKIFTEGEAQISQMCSSRVCRTELEDLVKVL YLERSEKGHC
    • Amino acids
      347 to 456
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164882 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CHL
    • chordin like 1
    • Chordin-like protein 1
    • CHRDL1
    • CRDL1_HUMAN
    • dA141H5.1
    • neuralin 1
    • Neuralin-1
    • Neurogenesin-1
    • NRLN1
    • Ventroptin
    • VOPT
    see all
  • Function
    Antagonizes the function of BMP4 by binding to it and preventing its interaction with receptors. Alters the fate commitment of neural stem cells from gliogenesis to neurogenesis. Contributes to neuronal differentiation of neural stem cells in the brain by preventing the adoption of a glial fate. May play a crucial role in dorsoventral axis formation. May play a role in embyonic bone formation (By similarity). May also play an important role in regulating retinal angiogenesis trough modulation of BMP4 actions in endothelial cells.
  • Tissue specificity
    Expressed in retinal pericytes.
  • Sequence similarities
    Contains 3 VWFC domains.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab164882 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164882 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164882.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up