Recombinant Human CHREBP protein (ab162408)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: WB, ELISA
Description
-
Product name
Recombinant Human CHREBP protein -
Expression system
Wheat germ -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
PPAPSGSERRLSGDLSSMPGPGTLSVRVSPPQPILSRGRPDSNKTENRRI THISAEQKRRFNIKLGFDTLHGLVSTLSAQPSLKVSKATTLQKTAEYI -
Amino acids
603 to 700 -
Tags
GST tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab162408 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Western blot
ELISA
-
Form
Liquid -
Additional notes
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- carbohydrate response element binding protein
- bHLHd14
- Carbohydrate responsive element binding protein
see all -
Function
Transcriptional repressor. Binds to the canonical and non-canonical E box sequences 5'-CACGTG-3'. -
Tissue specificity
Expressed in liver, heart, kidney, cerebellum and intestinal tissues. -
Involvement in disease
Note=WBSCR14 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. Haploinsufficiency of WBSCR14 may be the cause of certain cardiovascular and musculo-skeletal abnormalities observed in the disease. -
Sequence similarities
Contains 1 basic helix-loop-helix (bHLH) domain. -
Cellular localization
Nucleus. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab162408 has not yet been referenced specifically in any publications.