Recombinant Human Chromodomain helicase DNA binding protein 9 (ab164220)

Overview

  • Product name
    Recombinant Human Chromodomain helicase DNA binding protein 9
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLINLLVAQLNMCYLHTLSLIVLQSIPKTNPMVCFQMYQMAVQCGAIRQL LPFQIKMDLLFTNKDIHTLCIKIKALWHTMTLPYFRPMNNKHSVLHYAHN KTEIISTQGRILLASLKIL
    • Amino acids
      1 to 119
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164220 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1810014J18Rik
    • 9030205D12Rik
    • A330063D19Rik
    • AD-013
    • AD013
    • ATP dependent helicase CHD9
    • ATP-dependent helicase
    • CHD 9
    • CHD9
    • Chromatin related mesenchymal modulator
    • chromatin remodeling factor
    • Chromatin remodeling factor CHROM1
    • Chromodomain helicase DNA binding protein 9
    • Ciprofibrate bound protein p240
    • CReMM
    • KIAA0308
    • KISH2
    • Kismet homolog 2
    • mKIAA0308
    • Peroxisomal proliferator activated receptor A interacting complex 320 kDa protein
    • PPAR alpha interacting complex protein 320 kDa
    • PPAR-alpha-interacting complex protein 320 k
    • PPAR{gamma}-interacting cofactor 320 kDa
    • PRIC320
    • Proteinx0008
    see all
  • Cellular localization
    Cytoplasmic and Nuclear

Images

  • ab164220 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164220 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164220.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up