For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-chromogranin-a-protein-his-tag-ab229175.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Neuroscience Cell Type Marker Neuron marker Soma marker
Share by email

Recombinant Human Chromogranin A protein (His tag) (ab229175)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human Chromogranin A protein (His tag) (ab229175)

    Key features and details

    • Expression system: Baculovirus infected insect cells
    • Purity: > 85% SDS-PAGE
    • Endotoxin level: < 1.000 Eu/µg
    • Tags: His tag C-Terminus
    • Suitable for: SDS-PAGE

    Description

    • Product name

      Recombinant Human Chromogranin A protein (His tag)
      See all Chromogranin A proteins and peptides
    • Purity

      > 85 % SDS-PAGE.
      ab229175 was purified using conventional chromatography techniques.
    • Endotoxin level

      < 1.000 Eu/µg
    • Expression system

      Baculovirus infected insect cells
    • Accession

      P10645
    • Protein length

      Full length protein
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        ADLLPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDER ILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQA ELKEAVEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESKAEG NNQAPGEEEEEEEEATNTHPPASLPSQKYPGPQAEGDSEGLSQGLVDREK GLSAEPGWQAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEI RKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQG LFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEE DNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYP EEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRGHHHHHH
      • Predicted molecular weight

        50 kDa including tags
      • Amino acids

        19 to 457
      • Tags

        His tag C-Terminus
      • Additional sequence information

        This product is the mature full length protein from aa 19 to 457. The signal peptide is not included (NP_001266).

    Associated products

    • Related Products

      • Anti-Chromogranin A antibody (ab15160)
      • Anti-6X His tag® antibody [HIS.H8] (ab18184)
      • Anti-Chromogranin A antibody [CGA414] (ab187368)
      • Anti-6X His tag® antibody [4D11] (ab5000)
      • Anti-Chromogranin A antibody [EP1031Y] (ab52983)
      • Anti-6X His tag® antibody (ab9108)

    Specifications

    Our Abpromise guarantee covers the use of ab229175 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      SDS-PAGE

    • Form

      Liquid
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

      pH: 7.40
      Constituents: PBS, 20% Glycerol (glycerin, glycerine), 0.002% PMSF

    General Info

    • Alternative names

      • beta Granin
      • betagranin (N-terminal fragment of chromogranin A)
      • catestatin
      • CgA
      • CHG A
      • Chga
      • chromofungin
      • Chromogranin A
      • Chromogranin A parathyroid secretory protein 1
      • Chromogranin A precursor
      • ChromograninA
      • CMGA_HUMAN
      • ER-37
      • Pancreastatin
      • Parastatin
      • Parathyroid secretory protein 1
      • Pituitary secretory protein I
      • Secretory protein I
      • SP I
      • SP-I
      • SP1
      • SPI
      • Vasostatin
      • vasostatin 2
      • Vasostatin I
      • Vasostatin II
      • vasostatin-2
      see all
    • Function

      Pancreastatin strongly inhibits glucose induced insulin release from the pancreas.
    • Sequence similarities

      Belongs to the chromogranin/secretogranin protein family.
    • Post-translational
      modifications

      Sulfated on tyrosine residues and/or contains sulfated glycans.
      O-glycosylated with core 1 or possibly core 8 glycans.
    • Cellular localization

      Secreted. Neuroendocrine and endocrine secretory granules.
    • Target information above from: UniProt accession P10645 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant Human Chromogranin A protein (His tag) (ab229175)
      SDS-PAGE - Recombinant Human Chromogranin A protein (His tag) (ab229175)

      15% SDS-PAGE analysis of 3 µg ab229175.

      MW 50-70 kDa (SDS-PAGE under reducing conditions) .

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
    • SDS
  • References (0)

    Publishing research using ab229175? Please let us know so that we can cite the reference in this datasheet.

    ab229175 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab229175.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.