Overview

  • Product name

    Recombinant Human Chrono protein (Tagged)
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHGNLYFQGGGSDSPSSVSSYSSYSLSSSFPTS PVNSDFGFPSDSEREDKGAHGPRPDTVGQRGGSRPSPGPIRCRHRSKVSG NQHTPSHPKQRGSASPMAGSGAKRSRDGELETSLNTQGCTTEGDLLFAQK CKELQGFIPPLTDLLNGLKMGRFERGLSSFQQSVAMDRIQRIVGVLQKPQ MGERYLGTLLQVEGMLKTWFPQIAAQKSSLGGGKHQLTKHFPSHHSDSAA SSPASPMEKMDQTQLGHLALKPKQPWHLTQWPAMNLTWIHTTPICNPPLS SPGTISFSHGPLGTGTGIGVILFLQHGVQPFTHSAPTTPVPPTTASPVIP GEPMKLSGEGPRCYSLPVTLPSDWSYTLSPPSLPTLARKMTIGHREQQRS HPPVAADAHLLNL
    • Molecular weight

      44 kDa including tags
    • Amino acids

      2 to 385
    • Additional sequence information

      Constructed with a small T7-His-TEV cleavage site Tag (29 amino acids) fusion at the N-terminal.

Specifications

Our Abpromise guarantee covers the use of ab198673 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    ab198673 was expressed in E. coli as inclusion bodies, refolded using a unique temperature shift inclusion body refolding technology and chromatographically purified.
  • Form

    Liquid
  • Additional notes

    Previously labelled as C1orf51.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names

    • C1orf51
    • CA051_HUMAN
    • ChIP-Derived Repressor Of Network Oscillator
    • Chromosome 1 Open Reading Frame 51
    • CHRONO
    • Circadian Associated Repressor Of Transcription
    • Circadian-Associated Transcriptional Repressor
    • Computationally Highlighted Repressor Of The Network Oscillator
    • FLJ25889
    • GM129
    • Uncharacterized protein C1orf51
    see all
  • Information by UniProt

References

ab198673 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198673.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up