Description

  • Product name

    Recombinant Human CHST11 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      RKGDDVKFEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKY ETLEEDSNYVLQLAGVGSYLKFPTYAKSTRTTDEMTTEFFQNISSEHQTQ LYEVYKLD
    • Amino acids

      230 to 337
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153322 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C4S-1
    • C4ST
    • C4ST 1
    • C4ST-1
    • C4ST1
    • Carbohydrate (chondroitin 4) sulfotransferase 11
    • Carbohydrate sulfotransferase 11
    • Chondroitin 4 O sulfotransferase 1
    • Chondroitin 4 sulfotransferase
    • Chondroitin 4-O-sulfotransferase 1
    • Chondroitin 4-sulfotransferase 1
    • CHST 11
    • Chst11
    • CHSTB_HUMAN
    • HSA269537
    • IgH/CHST11 fusion
    see all
  • Function

    Catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. Can also sulfate Gal residues in desulfated dermatan sulfate. Preferentially sulfates in GlcA->GalNAc unit than in IdoA->GalNAc unit. Does not form 4, 6-di-O-sulfated GalNAc when chondroitin sulfate C is used as an acceptor.
  • Tissue specificity

    Widely expressed. Highly expressed in spleen, thymus, bone marrow, peripheral blood leukocytes, lymph node, heart, brain, lung and placenta.
  • Involvement in disease

    Note=A chromosomal aberration involving CHST11 is found in B-cell chronic lymphocytic leukemias. Translocation t(12;14)(q23;q32) with IgH.
  • Sequence similarities

    Belongs to the sulfotransferase 2 family.
  • Post-translational
    modifications

    N-glycosylated; required for activity and stability.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab153322 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153322 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153322.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up