Description

  • Product name

    Recombinant Human CHST12 protein
    See all CHST12 proteins and peptides
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MTKARLFRLWLVLGSVFMILLIIVYWDSAGAAHFYLHTSFSRPHTGPPLP TPGPDRDRELTADSDVDEFLDKFLSAGVKQSDLPRKETEQPPAPGSMEES VRGYDWSPRDARRSPDQGRQQAERRSVLRGFCANSSLAFPTKERAFDDIP NSELSHLIVDDRHGAIYCYVPKVACTNWKRVMIVLSGSLLHRGAPYRDPL RIPREHVHNASAHLTFNKFWRRYGKLSRHLMKVKLKKYTKFLFVRDPFVR LISAFRSKFELENEEFYRKFAVPMLRLYANHTSLPASAREAFRAGLKVSF ANFIQYLLDPHTEKLAPFNEHWRQVYRLCHPCQIDYDFVGKLETLDEDAA QLLQLLQVDRQLRFPPSYRNRTASSWEEDWFAKIPLAWRQQLYKLYEADF VLFGYPKPENLLRD
    • Amino acids

      1 to 414
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163098 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C4S 2
    • C4S2
    • C4ST 2
    • C4ST2
    • Carbohydrate (chondroitin 4) sulfotransferase 12
    • Chondroitin 4 O sulfotransferase 2
    • Chondroitin 4 sulfotransferase 2
    • Sulfotransferase Hlo
    see all
  • Relevance

    Catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin and desulfated dermatan sulfate. Does not form 4, 6-di-O-sulfated GalNAc when chondroitin sulfate C is used as an acceptor.
  • Cellular localization

    Golgi apparatus membrane; Single pass type II membrane protein

Images

  • ab163098 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163098 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163098.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up