Recombinant Human CHST14 protein (ab164997)

Overview

  • Product name
    Recombinant Human CHST14 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MFPRPLTPLAAPNGAEPLGRALRRAPLGRARAGLGGPPLLLPSMLMFAVI VASSGLLLMIERGILAEMKPLPLHPPGREGTAWRGKAPKPGGLSLRAGDA DLQVRQDVRNRTLRAVCGQPGMPRDPWDLPVGQRRTLLRHILVSDRYRFL YCYVPKVACSNWKRVMKVLAGVLDSVDVRLKMDHRSDLVFLADLRPEEIR YRLQHYFKFLFVREPLERLLSAYRNKFGEIREYQQRYGAEIVRRYRAGAG PSPAGDDVTFPEFLRYLVDEDPERMNEHWMPVYHLCQPCAVHYDFVGSYE RLEADANQVLEWVRAPPHVRFPARQAWYRPASPESLHYHLCSAPRALLQD VLPKYILDFSLFAYPLPNVTKEACQQ
    • Amino acids
      1 to 376
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164997 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2600016L03Rik
    • ATCS
    • Carbohydrate (N acetylgalactosamine 4 0) sulfotransferase 14
    • Carbohydrate sulfotransferase 14
    • CHST14
    • CHSTE_HUMAN
    • D4ST-1
    • D4st1
    • Dermatan 4-sulfotransferase 1
    • hD4ST1
    • RP23-286G12.2
    • UNQ1925/PRO4400
    see all
  • Function
    Catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of dermatan sulfate. Transfers sulfate to the C-4 hydroxyl of beta1,4-linked GalNAc that is substituted with an alpha-linked iduronic acid (IdoUA) at the C-3 hydroxyl. Transfers sulfate more efficiently to GalNAc residues in -IdoUA-GalNAc-IdoUA- than in -GlcUA-GalNAc-GlcUA-sequences. Has preference for partially desulfated dermatan sulfate. Addition of sulfate to GalNAc may occur immediately after epimerization of GlcUA to IdoUA.
  • Tissue specificity
    Widely expressed. Expressed at high level in pituitary gland, placenta, uterus and thyroid.
  • Involvement in disease
    Defects in CHST14 are the cause of Ehlers-Danlos syndrome musculocontractural type (EDSMC) [MIM:601776]. It is a form of Ehlers-Danlos syndrome characterized by distinctive craniofacial dysmorphism, congenital contractures of thumbs and fingers, clubfeet, severe kyphoscoliosis, muscular hypotonia, hyperextensible thin skin with easy bruisability and atrophic scarring, wrinkled palms, joint hypermobility, and ocular involvement.
  • Sequence similarities
    Belongs to the sulfotransferase 2 family.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab164997 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164997 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164997.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up