Recombinant Human CHST14 protein (ab164997)

Description

  • Product name

    Recombinant Human CHST14 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MFPRPLTPLAAPNGAEPLGRALRRAPLGRARAGLGGPPLLLPSMLMFAVI VASSGLLLMIERGILAEMKPLPLHPPGREGTAWRGKAPKPGGLSLRAGDA DLQVRQDVRNRTLRAVCGQPGMPRDPWDLPVGQRRTLLRHILVSDRYRFL YCYVPKVACSNWKRVMKVLAGVLDSVDVRLKMDHRSDLVFLADLRPEEIR YRLQHYFKFLFVREPLERLLSAYRNKFGEIREYQQRYGAEIVRRYRAGAG PSPAGDDVTFPEFLRYLVDEDPERMNEHWMPVYHLCQPCAVHYDFVGSYE RLEADANQVLEWVRAPPHVRFPARQAWYRPASPESLHYHLCSAPRALLQD VLPKYILDFSLFAYPLPNVTKEACQQ
    • Amino acids

      1 to 376
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164997 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 2600016L03Rik
    • ATCS
    • Carbohydrate (N acetylgalactosamine 4 0) sulfotransferase 14
    • Carbohydrate sulfotransferase 14
    • CHST14
    • CHSTE_HUMAN
    • D4ST-1
    • D4st1
    • Dermatan 4-sulfotransferase 1
    • hD4ST1
    • RP23-286G12.2
    • UNQ1925/PRO4400
    see all
  • Function

    Catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of dermatan sulfate. Transfers sulfate to the C-4 hydroxyl of beta1,4-linked GalNAc that is substituted with an alpha-linked iduronic acid (IdoUA) at the C-3 hydroxyl. Transfers sulfate more efficiently to GalNAc residues in -IdoUA-GalNAc-IdoUA- than in -GlcUA-GalNAc-GlcUA-sequences. Has preference for partially desulfated dermatan sulfate. Addition of sulfate to GalNAc may occur immediately after epimerization of GlcUA to IdoUA.
  • Tissue specificity

    Widely expressed. Expressed at high level in pituitary gland, placenta, uterus and thyroid.
  • Involvement in disease

    Defects in CHST14 are the cause of Ehlers-Danlos syndrome musculocontractural type (EDSMC) [MIM:601776]. It is a form of Ehlers-Danlos syndrome characterized by distinctive craniofacial dysmorphism, congenital contractures of thumbs and fingers, clubfeet, severe kyphoscoliosis, muscular hypotonia, hyperextensible thin skin with easy bruisability and atrophic scarring, wrinkled palms, joint hypermobility, and ocular involvement.
  • Sequence similarities

    Belongs to the sulfotransferase 2 family.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab164997 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164997 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164997.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up