Overview

  • Product name
    Recombinant Human CHST15 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRHCINCCIQLLPDGAHKQQVNCQGGPHHGHQACPTCKGENKILFRVDSK QMNLLAVLEVRTEGNENWGGFLRFKKGKRCSLVFGLIIMTLVMASYILSG AHQELLISSPFHYGGFPSNPSLMDSENPSDTKEHHHQSSVNNISYMKDYP SIKLIINSITTRIEFTTRQLPDLEDLKKQELHMFSVIPNKFLPNSKSPCW YEEFSGQNTTDPYLTNSYVLYSKRFRSTFDALRKAFWGHLAHAHGKHFRL RCLPHFYIIGQPKCGTTDLYDRLRLHPEVKFSAIKEPHWWTRKRFGIVRL RDGLRDRYPVEDYLDLFDLAAHQIHQGLQASSAKEQSKMNTIIIGEASAS TMWDNNAWTFFYDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYS DYLYFASSNKSADDFHEKVTEALQLFENCMLDYSLRACVYNNTLNNAMPV RLQVGLYAVYLLDWLSVFDKQQFLILRLEDHASNVKYTMHKVFQFLNLGP LSEKQEALMTKSPASNARRPEDRNLGPMWPITQKILRDFYRPFNARLAQV LADEAFAWKTT
    • Amino acids
      1 to 561
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162523 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • B cell RAG associated gene protein
    • B cell RAG associated protein
    • B-cell RAG-associated gene protein
    • BRAG
    • Carbohydrate sulfotransferase 15
    • Chst15
    • CHSTF_HUMAN
    • GALNAC4S 6ST
    • GalNAc4S-6ST
    • hBRAG
    • KIAA0598
    • N acetylgalactosamine 4 sulfate 6 O sulfotransferase
    • N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase
    • ST4S6
    see all
  • Function
    Sulfotransferase that transfers sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to the C-6 hydroxyl group of the GalNAc 4-sulfate residue of chondroitin sulfate A and forms chondroitin sulfate E containing GlcA-GalNAc(4,6-SO(4)) repeating units. It also transfers sulfate to a unique non-reducing terminal sequence, GalNAc(4SO4)-GlcA(2SO4)-GalNAc(6SO4), to yield a highly sulfated structure similar to the structure found in thrombomodulin chondroitin sulfate. May also act as a B-cell receptor involved in BCR ligation-mediated early activation that mediate regulatory signals key to B-cell development and/or regulation of B-cell-specific RAG expression; however such results are unclear in vivo.
  • Tissue specificity
    Expressed in B-cell-enriched tissues but not in fetal or adult thymus. Expressed in fetal and adult spleen, lymph node, tonsil, bone marrow and peripheral leukocytes. Not expressed in T-cells. In pro-B, pre-B, and mature B-cell lines, it colocalizes with RAG1.
  • Sequence similarities
    Belongs to the sulfotransferase 1 family.
  • Post-translational
    modifications
    Glycosylated.
  • Cellular localization
    Golgi apparatus membrane. A small fraction may also be present at the cell surface, where it acts as a B-cell receptor.
  • Information by UniProt

Images

  • ab162523 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162523 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162523.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up