Description

  • Product name

    Recombinant Human CIA protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAGMPGTAETFETPETCGTTDMRDSRDPMYRREGSYDRYLRMDDYCRRKD DSYFDRYRDSFDGRGPPGPESQSRAKERLKREERRREELYRQYFEEIQRR FDAERPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQA LEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVA RNYERYKNECREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPA IQSLINLLADNRYLTAEETDKIINYLRERKERLMRSSTDSLPGELRGRAE ARFPANHSGRPRVPR
    • Amino acids

      1 to 315
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163643 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Protein previously labeled as NCOA5.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • bA465L10.6
    • CIA
    • Coactivator independent of AF 2
    • KIAA1637
    • MGC28864
    • NCoA 5
    • NCOA5
    • Nuclear receptor coactivator 5
    • OTTMUSP00000001057
    • RP23-61O3.13
    see all
  • Relevance

    CIA is a nuclear receptor coregulator that can have both coactivator and corepressor functions. It interacts with nuclear receptors for steroids (ESR1 and ESR2) independently of the steroid binding domain (AF2) of the ESR receptors, and with the orphan nuclear receptor NR1D2. It Is also involved in the coactivation of nuclear steroid receptors (ER) as well as the corepression of MYC/c myc in response to 17 beta estradiol (E2).
  • Cellular localization

    Nuclear

Images

  • ab163643 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163643 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163643.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up