Description

  • Product name

    Recombinant Human CIDE A protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MRGDRASGGPGNHNGSWAREGPRLGPSWKRGLWSPRGGPNRPAEPSRPLT FMGSQTKRVLFTPLMHPARPFRVSNHDRSSRRGVMASSLQELISKTLDAL VIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWMPGSQHVP TCSPPKRSGIARVTFDLYRLNPKDFIGCLNVKATMYEMYSVSYDIRCTGL KGLLRSLLRFLSYSAQVTGQFLIYLGTYMLRVLDDKEERPSLRSQAKGRF TCG
    • Amino acids

      1 to 253
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152281 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cell death activator CIDE A
    • Cell Death Inducing DFFA Like Effector A
    • cell death inducing DNA fragmentation factor, alpha subunit like effector A
    • CIDE-A
    • CIDEA
    see all
  • Relevance

    Apoptosis is related to many diseases and induced by a family of cell death receptors and their ligands. Cell death signals are transduced by death domain containing adapter molecules and members of the caspase family of proteases. These death signals finally cause the degradation of chromosomal DNA by activated DNase. DFF45/ICARD has been identified as inhibitor of caspase activated DNase DFF40/CAD. DFF45 related proteins CIDE A and CIDE B (for cell death inducing DFF like effector A and B) were recently identified. CIDE contains a new type of domain termed CIDE N, which has high homology with the regulatory domains of DFF45/ICAD and DFF40/CAD. Expression of CIDE A induces DNA fragmentation and activates apoptosis, which is inhibited by DFF45. CIDE A is a DFF45 inhibitable effector that promotes cell death and DNA fragmentation. CIDE A is expressed in many tissues.
  • Cellular localization

    Nuclear. Cytoplasm; mitochondrial envelope; lipid droplet.

Images

  • ab152281 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152281 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152281.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up