Description

  • Product name

    Recombinant Human CILP protein
  • Purity

    > 90 % SDS-PAGE.
    ab182802 is expressed in E.coli as inclusion bodies. The final product was refolded and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHGNLYFQGGEFRQTMLTQSVRRVQPGKKNPSI FAKPADTLESPGEWTTWFNIDYPGGKGDYERLDAIRFYYGDRVCARPLRL EARTTDWTPAGSTGQVVHGSPREGFWCL NREQRPGQNCSNYTVRFLCPPGSLRRDTERIWSPWSPWSKCSAACGQTGV QTRTRICLAEMVSLCSEASEEGQHCMGQDCTACDLTCPMGQVNADCDACM CQDFMLHGAVSLPGGAPASGAAIYLLTKTPKLLTQTDSDGRFRIPGLCPD GKSILKITKVKFAPIVLTMPKTSLKAATIKAEFVRAETPYMVMNPETKAR RAGQSVSLCCKATGKPRPDKYFWYHNDTLLDPSLYKHESKLVLRKLQQHQ AGEYFCKAQSDAGAVKSKVAQLIVIASDETPCNPVPESYLIRLPHDCFQN ATNSFYYDVGRCPVKTCAGQQDNGIRCRDAVQNCCGISKTEEREIQCSGY TLPTKVAKECSCQRCTETRSIVRGRVSAADNGEPMRFGHVYMGNSRVSMT GYKGTFTLHVPQDTERLVLTFVDRLQKFVNTTKVLPFNKKGSAVFHEIKM LRRKKPITLEAMETNIIPLGEVVGEDPMAELEIPSRSFYRQNGEPYIGKV KASVTFLDPRNISTATAAQTDLNFINDEGDTFPLRTYGMFSVDFRDEVTS EPLNAGKVKVHLDSTQVKMPEHISTVKLWSLNPDTGLWEEEGDFKFENQR RNKR
    • Predicted molecular weight

      82 kDa
    • Amino acids

      22 to 724
    • Tags

      His-T7 tag N-Terminus
    • Additional sequence information

      Corresponds to CILP C1 protein; expressed with codon optimization and a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. NP_003604.

Specifications

Our Abpromise guarantee covers the use of ab182802 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituent: 0.32% Tris HCl

    Buffer also contains NaCl, KCl, EDTA, arginine, DTT and Glycerol.

General Info

  • Alternative names

    • cartilage intermediate layer protein
    • Cartilage intermediate layer protein 1
    • Cartilage intermediate layer protein 1 C1
    • Cartilage intermediate layer protein 1 C2
    • cartilage intermediate layer protein, nucleotide pyrophosphohydrolase
    • Cartilage intermediate-layer protein
    • CILP
    • CILP 1
    • CILP-1
    • CILP1_HUMAN
    • HGNC:1980
    • HsT18872
    see all
  • Function

    Probably plays a role in cartilage scaffolding. May act by antagonizing TGF-beta1 (TGFB1) and IGF1 functions. Has the ability to suppress IGF1-induced proliferation and sulfated proteoglycan synthesis, and inhibits ligand-induced IGF1R autophosphorylation. May inhibit TGFB1-mediated induction of cartilage matrix genes via its interaction with TGFB1. Overexpression may lead to impair chondrocyte growth and matrix repair and indirectly promote inorganic pyrophosphate (PPi) supersaturation in aging and osteoarthritis cartilage.
  • Tissue specificity

    Specifically expressed in cartilage. Localizes in the intermediates layer of articular cartilage but neither in the superficial nor in the deepest regions. Specifically and highly expressed in intervertebral disk tissue. Expression increases with aging in hip articular cartilage. Overexpressed in articular hyaline cartilage from patients with calcium pyrophosphate dihydrate crystal deposition disease (CPPD). Expression in intervertebral disk tissue from individuals with lumbar disk disease increases as disk degeneration progresses.
  • Involvement in disease

    Defects in CILP are a cause of susceptibility to intervertebral disk disease (IDD) [MIM:603932]. A common musculo-skeletal disorder caused by degeneration of intervertebral disks of the lumbar spine. It results in low-back pain and unilateral leg pain. Note=Susceptibility to intervertebral disk disease, is conferred by variant p.Ile395Thr (PubMed:15864306).
  • Sequence similarities

    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 TSP type-1 domain.
  • Post-translational
    modifications

    Cleaved into 2 chains possibly by a furin-like protease upon or preceding secretion.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

References

ab182802 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182802.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up