Recombinant Human CIRP protein (ab106903)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: MS, SDS-PAGE
Description
-
Product name
Recombinant Human CIRP protein
See all CIRP proteins and peptides -
Purity
> 95 % SDS-PAGE.
ab106903 is purified using conventional chromatography techniques. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MGSSHHHHHHSSGLVPRGSHMASDEGKLFVGGLSFDTNEQSLEQVFSKYG QISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVD QAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFES RSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE -
Predicted molecular weight
21 kDa including tags -
Amino acids
1 to 172 -
Tags
His tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab106903 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Mass Spectrometry
SDS-PAGE
-
Mass spectrometry
MALDI-TOF -
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
pH: 8.00
Constituents: 0.02% DTT, 0.32% Tris HCl, 50% Glycerol (glycerin, glycerine), 0.58% Sodium chloride
General Info
-
Alternative names
- A18 hnRNP
- A18HNRNP
- cirbp
see all -
Function
Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Acts as a translational activator. Seems to play an essential role in cold-induced suppression of cell proliferation. Binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts RPA2 and TXN. Acts as a translational repressor (By similarity). Promotes assembly of stress granules (SGs), when overexpressed. -
Tissue specificity
Ubiquitous. -
Sequence similarities
Contains 1 RRM (RNA recognition motif) domain. -
Domain
Both the RRM domain and the arginine, glycine (RGG) rich domain are necessary for binding to the TXN 3'-untranslated region. Both the RRM domain and the arginine, glycine (RGG) rich domain (RGG repeats) are necessary for optimal recruitment into SGs upon cellular stress. The C-terminal domain containing RGG repeats is necessary for translational repression. -
Post-translational
modificationsMethylated on arginine residues. Methylation of the RGG motifs is a prerequisite for recruitment into SGs.
Phosphorylated by CK2, GSK3A and GSK3B. Phosphorylation by GSK3B increases RNA-binding activity to the TXN 3'-UTR transcript upon exposure to UV radiation. -
Cellular localization
Nucleus > nucleoplasm. Cytoplasm. Translocates from the nucleus to the cytoplasm after exposure to UV radiation. Translocates from the nucleus to the cytoplasm into stress granules upon various cytoplasmic stresses, such as osmotic and heat shocks. Its recruitment into stress granules occurs in the absence of TIAR proteins. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab106903 has not yet been referenced specifically in any publications.