Overview

  • Product name
    Recombinant Human CISD2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRLLPFLGVLAL LGYLAVRPFLPKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCR CWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV
    • Amino acids
      1 to 135
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166558 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1500009M05Rik
    • 1500026J14Rik
    • 1500031D15Rik
    • AI848398
    • B630006A20Rik
    • CDGSH iron sulfur domain 2
    • CDGSH iron-sulfur domain-containing protein 2
    • CDGSH type domain 2
    • CISD2
    • CISD2_HUMAN
    • Endoplasmic reticulum intermembrane small protein
    • ERIS
    • Miner1
    • MitoNEET related 1
    • MitoNEET-related 1 protein
    • NAF-1
    • Noxp70
    • Nutrient deprivation autophagy factor 1
    • Nutrient-deprivation autophagy factor-1
    • OTTHUMP00000219576
    • RGD1566242
    • WFS2
    • Zcd2
    • Zinc finger
    • Zinc finger, CDGSH type domain 2
    see all
  • Function
    Regulator of autophagy that contributes to antagonize BECN1-mediated cellular autophagy at the endoplasmic reticulum. Participates in the interaction of BCL2 with BECN1 and is required for BCL2-mediated depression of endoplasmic reticulum Ca(2+) stores during autophagy. Contributes to BIK-initiated autophagy, while it is not involved in BIK-dependent activation of caspases. Involved in life span control, probably via its function as regulator of autophagy.
  • Tissue specificity
    Testis, small intestine, kidney, lung, brain, heart, pancreas and platelets.
  • Involvement in disease
    Defects in CISD2 are the cause of Wolfram syndrome type 2 (WFS2) [MIM:604928]. A rare disorder characterized by juvenile-onset insulin-dependent diabetes mellitus with optic atrophy. Other manifestations include diabetes insipidus, sensorineural deafness, dementia, psychiatric illnesses. WFS2 patients additionally show a strong bleeding tendency and gastrointestinal ulceration. Diabetes insipidus may be absent.
  • Sequence similarities
    Belongs to the CISD protein family. CISD2 subfamily.
  • Cellular localization
    Endoplasmic reticulum membrane. Mitochondrion outer membrane. According to PubMed:20010695, it mainly localizes to the endoplasmic reticulum. However, experiments in mouse showed that it mainly localizes to the mitochondrion outer membrane.
  • Information by UniProt

Images

  • ab166558 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166558 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166558.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up