Description

  • Product name

    Recombinant human CIT protein
  • Biological activity

    The specific activity of ab179954 was determined to be 5 nmol/min/mg.

  • Purity

    > 70 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MLKFKYGARNPLDAGAAEPIASRASRLNLFFQGKPPFMTQQQMSPLSREG ILDALFVLFEECSQPALMKIKHVSNFVRKYSDTIAELQELQPSAKDFEVR SLVGCGHFAEVQVVREKATGDIYAMKVMKKKALLAQEQVSFFEEERNILS RSTSPWIPQLQYAFQDKNHLYLVMEYQPGGDLLSLLNRYEDQLDENLIQF YLAELILAVHSVHLMGYVHRDIKPENILVDRTGHIKLVDFGSAAKMNSNK MVNAKLPIGTPDYMAPEVLTVMNGDGKGTYGLDCDWWSVGVIAYEMIYGR SPFAEGTSARTFNNIMNFQRFLKFPDDPKVSSDFLDLIQSLLCGQKERLK FEGLCCHPFFSKIDWNNIRNSPPPFVPTLKSDDDTSNFDEPEKNSWVSSS PCQLSPSGFSGEELPFVGFSYSKALGILGRSESVVSGLDSPAKTSSMEK
    • Predicted molecular weight

      74 kDa including tags
    • Amino acids

      1 to 449
    • Tags

      proprietary tag N-Terminus
    • Additional sequence information

      NM_007174

Associated products

Specifications

Our Abpromise guarantee covers the use of ab179954 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    ab64311 (Myelin Basic Protein protein) can be utilized as a substrate for assessing kinase activity

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.79% Tris HCl, 25% Glycerol, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.88% Sodium chloride, 0.002% PMSF

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Citron
    • Citron (rho interacting serine/threonine kinase 21)
    • Citron Rho interacting kinase
    • CRIK
    • EC 2.7.11.1
    • KIAA0949
    • Rho interacting serine/threonine kinase 21
    • Rho interacting serine/threonine protein kinase 21
    • serine/threonine-protein kinase 21
    • STK2
    • STK21
    see all
  • Relevance

    CIT is a putative RHO/RAC effector that binds to the GTP bound forms of RHO and RAC1. It probably binds p21 with a tighter specificity in vivo. This protein exhibits dual specificity protein kinase activity catalyzing autophosphorylation and phosphorylation of exogenous substrates on both serine/threonine and tyrosine residues. CIT plays an important role in the regulation of cytokinesis and the development of the central nervous system.
  • Cellular localization

    Cytoplasmic

Images

  • Sample Kinase Activity Plot.

    The specific activity of ab179954 was determined to be 5 nmol/min/mg.

     

  • SDS-PAGE analysis of ab179954.

References

ab179954 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179954.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up