Overview

  • Product name

    Recombinant Human CITED4 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      GMDAELIDEEALTSLELELGLHRVRELPELFLGQSEFDCFSDLGSAPPAG SVSC
    • Amino acids

      131 to 184
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153612 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AU019445
    • AW742964
    • Cbp/p300 interacting transactivator 4
    • cbp/p300 interacting transactivator, with glu/asp rich carboxy terminal domain, 4
    • Cbp/p300-interacting transactivator 4
    • CITE4_HUMAN
    • Cited4
    • MRG 2
    • MRG-2
    • Mrg2
    • MSG1 related protein 2
    • MSG1-related protein 2
    • Transcriptional co-activator 4
    see all
  • Function

    Acts as transcriptional coactivator for TFAP2/AP-2. Enhances estrogen-dependent transactivation mediated by estrogen receptors. May function as an inhibitor of transactivation by HIF1A by disrupting HIF1A interaction with CREBBP. May be involved in regulation of gene expression during development and differentiation of blood cells, endothelial cells and mammary epithelial cells.
  • Tissue specificity

    Expressed in most tissues examined with highest levels of expression in heart, liver, skeletal muscle and pancreas. Also expressed in bladder cell line ECV304 and in various breast cancer cell lines. Also detected in both in situ and invasive breast tumors where its expression is down-regulated and mostly restricted to the cytoplasm of malignant epithelium. Down-regulation of expression is associated with elevated levels of HIF1A and increased tumor growth and angiogenesis.
  • Sequence similarities

    Belongs to the CITED family.
  • Cellular localization

    Nucleus. Cytoplasm.
  • Information by UniProt

Images

  • ab153612 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153612 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153612.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up