Recombinant Human CLASP1 protein (ab161605)

Overview

  • Product name
    Recombinant Human CLASP1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DGLAKHPPPFSQPNSIPTAPSHKALRRSYSPSMLDYDTENLNSEEIYSSL RGVTEAIEKFSFRSQEDLNEPIKRDGKKECDIVSRDGGAASPAT
    • Amino acids
      1133 to 1226
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161605 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1700030C23Rik
    • 5730583A19Rik
    • B130045P17Rik
    • CLAP1_HUMAN
    • clasp1
    • CLIP associating protein 1
    • CLIP associating protein CLASP1
    • CLIP-associating protein 1
    • Cytoplasmic linker associated protein 1
    • Cytoplasmic linker-associated protein 1
    • DKFZp686D1968
    • DKFZp686H2039
    • FLJ33821
    • FLJ41222
    • hOrbit1
    • KIAA0622
    • MAST1
    • MGC131895
    • mKIAA0622
    • Multiple asters 1
    • Multiple asters homolog 1
    • Protein Orbit homolog 1
    see all
  • Function
    Microtubule plus-end tracking protein that promotes the stabilization of dynamic microtubules. Involved in the nucleation of noncentrosomal microtubules originating from the trans-Golgi network (TGN). Required for the polarization of the cytoplasmic microtubule arrays in migrating cells towards the leading edge of the cell. May act at the cell cortex to enhance the frequency of rescue of depolymerizing microtubules by attaching their plus-ends to cortical platforms composed of ERC1 and PHLDB2. This cortical microtubule stabilizing activity is regulated at least in part by phosphatidylinositol 3-kinase signaling. Also performs a similar stabilizing function at the kinetochore which is essential for the bipolar alignment of chromosomes on the mitotic spindle.
  • Sequence similarities
    Belongs to the CLASP family.
    Contains 7 HEAT repeats.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm > cytoskeleton. Cytoplasm > cytoskeleton > centrosome. Chromosome > centromere > kinetochore. Cytoplasm > cytoskeleton > spindle. Golgi apparatus > trans-Golgi network. Localizes to microtubule plus ends. Localizes to centrosomes, kinetochores and the mitotic spindle from prometaphase. Subsequently localizes to the spindle midzone from anaphase and to the midbody from telophase. In migrating cells localizes to the plus ends of microtubules within the cell body and to the entire microtubule lattice within the lamella. Localizes to the cell cortex and this requires ERC1 and PHLDB2.
  • Information by UniProt

Images

  • ab161605 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161605 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161605.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up