Overview

  • Product name

    Recombinant Human Claudin 1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MANAGLQLLGFILAFLGWIGAIVSTALPQWRIYSYAGDNIVTAQAMYEGL WMSCVSQSTGQIQCKVFDSLLNLSSTLQATRALMVVGILLGVIAIFVATV GMKCMKCLEDDEVQKMRMAVIGGAIFLLAGLAILVATAWYGNRIVQEFYD PMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYP KPAPSSGKDYV
    • Amino acids

      1 to 211
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152949 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Claudin-1
    • Claudin1
    • CLD 1
    • CLD1
    • CLD1_HUMAN
    • CLDN 1
    • Cldn1
    • ILVASC
    • SEMP 1
    • SEMP1
    • Senescence associated epithelial membrane protein
    • Senescence associated epithelial membrane protein 1
    • Senescence-associated epithelial membrane protein
    see all
  • Function

    Claudins function as major constituents of the tight junction complexes that regulate the permeability of epithelia. While some claudin family members play essential roles in the formation of impermeable barriers, others mediate the permeability to ions and small molecules. Often, several claudin family members are coexpressed and interact with each other, and this determines the overall permeability. CLDN1 is required to prevent the paracellular diffusion of small molecules through tight junctions in the epidermis and is required for the normal barrier function of the skin. Required for normal water homeostasis and to prevent excessive water loss through the skin, probably via an indirect effect on the expression levels of other proteins, since CLDN1 itself seems to be dispensable for water barrier formation in keratinocyte tight junctions (PubMed:23407391).
    (Microbial infection) Acts as a receptor for hepatitis C virus in hepatocytes (PubMed:17325668). Acts as a receptor for dengue virus (PubMed:24074594).
  • Tissue specificity

    Strongly expressed in liver and kidney. Expressed in heart, brain, spleen, lung and testis.
  • Involvement in disease

    Ichthyosis-sclerosing cholangitis neonatal syndrome
  • Sequence similarities

    Belongs to the claudin family.
  • Cellular localization

    Cell junction, tight junction. Cell membrane.
  • Information by UniProt

Images

  • ab152949 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152949 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152949.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up