Overview

  • Product name

    Recombinant Human Claudin 14 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGL WMECVWHSTGIYQCQIYRSLLALPQDLQAARALMVISCLLSGIACACAVI GMKCTRCAKGTPAKTTFAILGGTLFILAGLLCMVAVSWTTNDVVQNFYNP LLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQDEAPYRPYQAPPRA TTTTANTAPAYQPPAAYKDNRAPSVTSATHSGYRLNDYV
    • Molecular weight

      52 kDa including tags
    • Amino acids

      1 to 239

Specifications

Our Abpromise guarantee covers the use of ab132203 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AI851731
    • Claudin 14
    • Claudin-14
    • CLD14_HUMAN
    • CLDN 14
    • CLDN14
    • DFNB 29
    • DFNB29
    • Human CLDN14 gene
    • MGC109472
    • OTTHUMP00000109046
    • OTTHUMP00000109049
    • OTTMUSP00000021531
    • UNQ777/PRO1571
    see all
  • Function

    Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
  • Tissue specificity

    Liver, kidney. Also found in ear.
  • Involvement in disease

    Defects in CLDN14 are the cause of deafness autosomal recessive type 29 (DFNB29) [MIM:605608]. DFNB29 is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information.
  • Sequence similarities

    Belongs to the claudin family.
  • Cellular localization

    Cell junction > tight junction. Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132203 stained with Coomassie Blue.

References

ab132203 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132203.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up