Overview

  • Product name

    Recombinant Human Claudin 17 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAFYPLQIAGLVLGFLGMVGTLATTLLPQWRVSAFVGSNIIVFERLWEGL WMNCIRQARVRLQCKFYSSLLALPPALETARALMCVAVALSLIALLIGIC GMKQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYN PAIHIGQKRELGAALFLGWASAAVLFIGGGLLCGFCCCNRKKQGYRYPVP GYRVPHTDKRRNTTMLSKTSTSYV
    • Amino acids

      1 to 224
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153275 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CLDN17
    • Human CLDN17 gene for claudin 17
  • Relevance

    Claudin proteins are a family of transmembrane proteins associated with tight junctions, and different tissues exhibit different Claudin composition. There are 18 homolgs present in humans, and mutations in any of these proteins cause a variety of human disease, this indicates their physiological importance. CLDN17, clustered with CLDN8 at human chromosome 21q22.11, is a four transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.
  • Cellular localization

    Integral membrane protein. Tight junctions.

Images

  • ab153275 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153275 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153275.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up