Description

  • Product name

    Recombinant Human Claudin 3 protein (Tagged)
    See all Claudin 3 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      RVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAA R
    • Predicted molecular weight

      20 kDa including tags
    • Amino acids

      30 to 80
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 6xHis-B2M-tag. Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab235064 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • C7orf1
    • Claudin-3
    • Claudin3
    • CLD3_HUMAN
    • CLDN 3
    • Cldn3
    • Clostridium perfringens enterotoxin receptor 2
    • CPE R2
    • CPE receptor 2
    • CPE-R 2
    • CPE-receptor 2
    • CPETR 2
    • CPETR2
    • HRVP 1
    • HRVP1
    • Rat ventral prostate 1 like protein
    • Rat ventral prostate.1 protein homolog
    • RVP1
    • Ventral prostate.1 like protein
    • Ventral prostate.1 protein homolog
    see all
  • Function

    Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
  • Involvement in disease

    Note=CLDN3 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region.
  • Sequence similarities

    Belongs to the claudin family.
  • Cellular localization

    Cell junction > tight junction. Cell membrane.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab235064.

References

ab235064 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235064.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up