Overview

  • Product name

    Recombinant Human Claudin 5 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSAALEILGLVLCLVGWGGLILACGLPMWQVTAFLDHNIVTAQTTWKGL WMSCVVQSTGHMQCKVYDSVLALSTEVQAARALTVSAVLLAFVALFVTLA GAQCTTCVAPGPAKARVALTGGVLYLFCGLLALVPLCWFANIVVREFYDP SVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKY SAPRRPTATGDYDKKNYV
    • Molecular weight

      50 kDa including tags
    • Amino acids

      1 to 218

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152754 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Androgen withdrawal and apoptosis induced protein RVP1 like
    • AWAL
    • BEC 1
    • BEC1
    • Claudin 5 (transmembrane protein deleted in velocardiofacial syndrome)
    • Claudin-5
    • Claudin5
    • CLD5_HUMAN
    • CLDN 5
    • Cldn5
    • CPETR L1
    • CPETRL 1
    • CPETRL1
    • TMDVCF
    • TMVCF
    • Transmembrane protein deleted in VCFS
    • Transmembrane protein deleted in velocardiofacial syndrome
    see all
  • Function

    Plays a major role in tight junction-specific obliteration of the intercellular space.
  • Sequence similarities

    Belongs to the claudin family.
  • Cellular localization

    Cell junction > tight junction. Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152754 stained with Coomassie Blue.

References

ab152754 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152754.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up